Millipore Sigma Vibrant Logo

219482 Caveolin-1 Scaffolding Domain Peptide, Cell-permeable - Calbiochem

Caveolin-1 Scaffolding Domain Peptide, Cell-permeable, blocks eNOS activity and cellular NO release in vitro and reduces inflammation and tumorigenesis in vivo.

SDB (Sicherheitsdatenblätter), Analysenzertifikate und Qualitätszertifikate, Dossiers, Broschüren und andere verfügbare Dokumente.

Synonyme: AP-Cav, Pen-C1-SD, RQIKIWFQNRRMKWKK-DGIWKASFTTFTVTKYWFYR, Cavtratin

Primary Target: eNOS
View Products on Sigmaaldrich.com
219482
Preis & Verfügbarkeit

Übersicht

Replacement Information

Key Spec Table

Empirical Formula
C₂₂₈H₃₃₅N₆₁O₄₉S

Preis & Verfügbarkeit

Bestellnummer VerfügbarkeitVerpackung St./Pkg. Preis Menge
219482-1MG
Verfügbarkeit wird abgerufen...
—
Eingeschränkte Verfügbarkeit Eingeschränkte Verfügbarkeit
Lieferbar 
Produkt wurde eingestellt
Begrenzter Lagerbestand
Bestätigung der Verfügbarkeit erforderlich
    Restmenge: Angebot folgt
      Restmenge: Angebot folgt
      Bitte erfragen
      Kontakt zum Kundenservice
      Contact Customer Service

      		 Kst.-Ampulle 1 mg
      Preis wird abgerufen...
      Preis nicht abrufbar
      Die Mindestmenge muss ein Vielfaches sein von
      Maximum Quantity is
      Bei Bestätigung Weitere Informationen
      Sie haben () gespart
       
      —
      Bitte erfragen
      		 —
      Description
      OverviewCaveolin-1 scaffolding domain peptide (C1-SD82-101) fused at the N-terminus to the cell-permeable Antennapedia internalization sequence (43-58). This peptide is reported to block eNOS activity and cellular NO release in vitro and reduce inflammation and tumorigenesis in vivo. Caveolin-1 interacts with several lipid-modified signaling ligands, such as EGFR, eNOS, G-protein α-subunits, PKCα, H-Ras, and Src, via the C1-SD82-101 sequence.
      Catalogue Number219482
      Brand Family Calbiochem®
      SynonymsAP-Cav, Pen-C1-SD, RQIKIWFQNRRMKWKK-DGIWKASFTTFTVTKYWFYR, Cavtratin
      References
      ReferencesBernatchez, P.N., et al. 2005. Proc. Natl. Acad. Sci. USA 102, 761.
      Williams, T.M., et al. 2004. J. Biol. Chem. 279, 51630.
      Gratton, J.P., et al. 2003. Cancer Cell 4, 31.
      Sukumaran, S.K., et al. 2002. J. Biol. Chem. 277, 50716.
      Liu, J., et al. 2002. J. Biol. Chem. 277, 10661.
      Bucci, M., et al. 2000. Nat. Med. 6, 1362.
      Okamoto, T., et al. 1998. J. Biol. Chem. 273, 5419.
      Product Information
      ATP CompetitiveN
      FormWhite lyophilized solid
      FormulationSupplied as a trifluoroacetate salt.
      Hill FormulaC₂₂₈H₃₃₅N₆₁O₄₉S
      Chemical formulaC₂₂₈H₃₃₅N₆₁O₄₉S
      Hygroscopic Hygroscopic
      ReversibleN
      Quality LevelMQ100
      Applications
      ApplicationCaveolin-1 Scaffolding Domain Peptide, Cell-permeable, blocks eNOS activity and cellular NO release in vitro and reduces inflammation and tumorigenesis in vivo.
      Biological Information
      Primary TargeteNOS
      Purity≥95% by HPLC
      Physicochemical Information
      Cell permeableY
      Peptide SequenceH-Arg-Gln-Ile-Lys-Ile-Trp-Phe-Gln-Asn-Arg-Arg-Met-Lys-Trp-Lys-Lys-Asp-Gly-Ile-Trp-Lys-Ala-Ser-Phe-Thr-Thr-Phe-Thr-Val-Thr-Lys-Tyr-Trp-Phe-Tyr-Arg-OH
      Dimensions
      Materials Information
      Toxicological Information
      Safety Information according to GHS
      Safety Information
      Product Usage Statements
      Storage and Shipping Information
      Ship Code Shipped with Blue Ice or with Dry Ice
      Toxicity Carcinogenic / Teratogenic
      Storage -20°C
      Protect from Light Protect from light
      Hygroscopic Hygroscopic
      Do not freeze Ok to freeze
      Special InstructionsFollowing reconstitution, aliquot and freeze (-20°C). Stock solutions are stable for up to 3 months at -20°C.
      Packaging Information
      Packaged under inert gas Packaged under inert gas
      Transport Information
      Supplemental Information
      Specifications
      Global Trade Item Number
      Bestellnummer GTIN
      219482-1MG 04055977218565

      Documentation

      Caveolin-1 Scaffolding Domain Peptide, Cell-permeable - Calbiochem SDB

      Titel

      Sicherheitsdatenblatt (SDB) 

      Caveolin-1 Scaffolding Domain Peptide, Cell-permeable - Calbiochem Analysenzertifikate

      TitelChargennummer
      219482

      Literatur

      Übersicht
      Bernatchez, P.N., et al. 2005. Proc. Natl. Acad. Sci. USA 102, 761.
      Williams, T.M., et al. 2004. J. Biol. Chem. 279, 51630.
      Gratton, J.P., et al. 2003. Cancer Cell 4, 31.
      Sukumaran, S.K., et al. 2002. J. Biol. Chem. 277, 50716.
      Liu, J., et al. 2002. J. Biol. Chem. 277, 10661.
      Bucci, M., et al. 2000. Nat. Med. 6, 1362.
      Okamoto, T., et al. 1998. J. Biol. Chem. 273, 5419.
      Datenblatt

      Note that this data sheet is not lot-specific and is representative of the current specifications for this product. Please consult the vial label and the certificate of analysis for information on specific lots. Also note that shipping conditions may differ from storage conditions.

      Revision05-June-2008 RFH
      SynonymsAP-Cav, Pen-C1-SD, RQIKIWFQNRRMKWKK-DGIWKASFTTFTVTKYWFYR, Cavtratin
      DescriptionCaveolin-1 scaffolding domain peptide (C1-SD82-101) fused at the N-terminus to the cell-permeable Antennapedia internalization sequence (43-58). This peptide is reported to block eNOS activity and cellular NO release in vitro and reduce inflammation and tumorigenesis in vivo. Caveolin-1 interacts with several lipid-modified signaling ligands, such as EGFR, eNOS, G-protein α-subunits, PKCα, H-Ras, and Src, via the C1-SD82-101 sequence.
      FormWhite lyophilized solid
      FormulationSupplied as a trifluoroacetate salt.
      Intert gas (Yes/No) Packaged under inert gas
      Chemical formulaC₂₂₈H₃₃₅N₆₁O₄₉S
      Peptide SequenceH-Arg-Gln-Ile-Lys-Ile-Trp-Phe-Gln-Asn-Arg-Arg-Met-Lys-Trp-Lys-Lys-Asp-Gly-Ile-Trp-Lys-Ala-Ser-Phe-Thr-Thr-Phe-Thr-Val-Thr-Lys-Tyr-Trp-Phe-Tyr-Arg-OH
      Purity≥95% by HPLC
      SolubilityDMSO (2 mg/ml)
      Storage Protect from light
      -20°C
      Hygroscopic
      Do Not Freeze Ok to freeze
      Special InstructionsFollowing reconstitution, aliquot and freeze (-20°C). Stock solutions are stable for up to 3 months at -20°C.
      Toxicity Carcinogenic / Teratogenic
      ReferencesBernatchez, P.N., et al. 2005. Proc. Natl. Acad. Sci. USA 102, 761.
      Williams, T.M., et al. 2004. J. Biol. Chem. 279, 51630.
      Gratton, J.P., et al. 2003. Cancer Cell 4, 31.
      Sukumaran, S.K., et al. 2002. J. Biol. Chem. 277, 50716.
      Liu, J., et al. 2002. J. Biol. Chem. 277, 10661.
      Bucci, M., et al. 2000. Nat. Med. 6, 1362.
      Okamoto, T., et al. 1998. J. Biol. Chem. 273, 5419.