Millipore Sigma Vibrant Logo

05-23-2005 Neuropeptide Y, Human - CAS 90880-35-6 - Calbiochem

View Products on Sigmaaldrich.com
05-23-2005
Ver preços e disponibilidade

Panorama geral

Replacement Information

Tabela com principais espec.

CAS #Empirical Formula
90880-35-6C₁₈₉H₂₈₅N₅₅O₅₇S

Preço e Disponibilidade

Número de catálogo DisponibilidadeEmbalagem Qtde/Emb. Preço Quantidade
US105232005-0.5MG
Verificando a disponibilidade...
Disponibilidade limitada
Disponibilidade limitada
Insira quantidade 
Descontinuado
Quantidades limitadas disponíveis
Disponibilidade a ser confirmada
    Restante: será informado
      Restante: será informado
      Vai informar
      Contatar o serviço de atendimento ao cliente
      Contact Customer Service

      Frasco de vidro .5 mg
      Recuperando preço...
      O preço não pôde ser recuperado
      Quantidade mínima necessária para ser múltipla de
      Maximum Quantity is
      Após finalização do pedido Mais informações
      Você salvou ()
       
      Solicitar preço
      Description
      OverviewA potent vasoconstrictor. Reversibly inhibits Ca2+-activated K+ channels in vascular smooth muscle cells.
      Catalogue Number05-23-2005
      Brand Family Calbiochem®
      SynonymsNPY, Human, YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY-NH₂
      References
      ReferencesXiong, Z., and Cheung, D.W. 1994. Pflugers Arch. 429, 280.
      Wahlestedt, C., et al. 1993. Science 259, 528.
      Leibowitz, S.F. 1992. NeuroReport 3, 1023.
      Product Information
      CAS number90880-35-6
      ATP CompetitiveN
      FormWhite to off-white lyophilized solid
      FormulationSupplied as trifluoroacetate salt. Sold on the basis of peptide content.
      Hill FormulaC₁₈₉H₂₈₅N₅₅O₅₇S
      Chemical formulaC₁₈₉H₂₈₅N₅₅O₅₇S
      ReversibleY
      Sold on the basis of peptide contentY
      Quality LevelMQ100
      Applications
      Biological Information
      Primary TargetA potent vasoconstrictor
      Purity≥97% by HPLC
      Physicochemical Information
      Cell permeableN
      Peptide ContentY
      Peptide SequenceH-Tyr-Pro-Ser-Lys-Pro-Asp-Asn-Pro-Gly-Glu-Asp-Ala-Pro-Ala-Glu-Asp-Met-Ala-Arg-Tyr-Tyr-Ser-Ala-Leu-Arg-His-Tyr-Ile-Asn-Leu-Ile-Thr-Arg-Gln-Arg-Tyr-NH₂
      Dimensions
      Materials Information
      Toxicological Information
      Safety Information according to GHS
      Safety Information
      R PhraseR: 20/21/22

      Harmful by inhalation, in contact with skin and if swallowed.
      S PhraseS: 36

      Wear suitable protective clothing.
      Product Usage Statements
      Storage and Shipping Information
      Ship Code Ambient Temperature Only
      Toxicity Harmful
      Storage -20°C
      Protect from Moisture Protect from moisture
      Do not freeze Ok to freeze
      Special InstructionsFollowing reconstitution, aliquot and freeze (-20°C). Stock solutions are stable for up to 3 months at -20°C.
      Packaging Information
      Transport Information
      Supplemental Information
      Specifications
      Global Trade Item Number
      Número de catálogo GTIN
      US105232005-0.5MG 04055977206371

      Documentation

      Neuropeptide Y, Human - CAS 90880-35-6 - Calbiochem MSDS

      Título

      Ficha de Segurança de Produtos (MSDS) 

      Neuropeptide Y, Human - CAS 90880-35-6 - Calbiochem Certificados de análise

      TítuloNúmero do lote
      05-23-2005

      Referências

      Visão geral de referência
      Xiong, Z., and Cheung, D.W. 1994. Pflugers Arch. 429, 280.
      Wahlestedt, C., et al. 1993. Science 259, 528.
      Leibowitz, S.F. 1992. NeuroReport 3, 1023.
      Ficha de dados

      Note that this data sheet is not lot-specific and is representative of the current specifications for this product. Please consult the vial label and the certificate of analysis for information on specific lots. Also note that shipping conditions may differ from storage conditions.

      Revision18-September-2008 RFH
      SynonymsNPY, Human, YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY-NH₂
      DescriptionA potent vasoconstrictor. Reversibly inhibits Ca2+-activated K+ channels in vascular smooth muscle cells.
      FormWhite to off-white lyophilized solid
      FormulationSupplied as trifluoroacetate salt. Sold on the basis of peptide content.
      CAS number90880-35-6
      Chemical formulaC₁₈₉H₂₈₅N₅₅O₅₇S
      Peptide SequenceH-Tyr-Pro-Ser-Lys-Pro-Asp-Asn-Pro-Gly-Glu-Asp-Ala-Pro-Ala-Glu-Asp-Met-Ala-Arg-Tyr-Tyr-Ser-Ala-Leu-Arg-His-Tyr-Ile-Asn-Leu-Ile-Thr-Arg-Gln-Arg-Tyr-NH₂
      Purity≥97% by HPLC
      Solubility5% Acetic acid (1 mg/ml)
      Storage Protect from moisture
      -20°C
      Do Not Freeze Ok to freeze
      Special InstructionsFollowing reconstitution, aliquot and freeze (-20°C). Stock solutions are stable for up to 3 months at -20°C.
      Toxicity Harmful
      Merck USA index14, 6485
      ReferencesXiong, Z., and Cheung, D.W. 1994. Pflugers Arch. 429, 280.
      Wahlestedt, C., et al. 1993. Science 259, 528.
      Leibowitz, S.F. 1992. NeuroReport 3, 1023.