Millipore Sigma Vibrant Logo

219482 Caveolin-1 Scaffolding Domain Peptide, Cell-permeable - Calbiochem

Caveolin-1 Scaffolding Domain Peptide, Cell-permeable, blocks eNOS activity and cellular NO release in vitro and reduces inflammation and tumorigenesis in vivo.

Ficha de dados de segurança do material (FDSM) ou ficha de segurança do material (FSM), certificado de análise (CA) e certificado de qualidade (CQ), dossiês e outros documentos disponíveis.

Sinônimos: AP-Cav, Pen-C1-SD, RQIKIWFQNRRMKWKK-DGIWKASFTTFTVTKYWFYR, Cavtratin

Primary Target: eNOS
View Products on Sigmaaldrich.com
219482
Ver preços e disponibilidade

Panorama geral

Replacement Information

Tabela com principais espec.

Empirical Formula
C₂₂₈H₃₃₅N₆₁O₄₉S

Preço e Disponibilidade

Número de catálogo DisponibilidadeEmbalagem Qtde/Emb. Preço Quantidade
219482-1MG
Verificando a disponibilidade...
—
Disponibilidade limitada Disponibilidade limitada
Insira quantidade 
Descontinuado
Quantidades limitadas disponíveis
Disponibilidade a ser confirmada
    Restante: será informado
      Restante: será informado
      Vai informar
      Contatar o serviço de atendimento ao cliente
      Contact Customer Service

      		 Ampola plástica 1 mg
      Recuperando preço...
      O preço não pôde ser recuperado
      Quantidade mínima necessária para ser múltipla de
      Maximum Quantity is
      Após finalização do pedido Mais informações
      Você salvou ()
       
      —
      Solicitar preço
      		 —
      Description
      OverviewCaveolin-1 scaffolding domain peptide (C1-SD82-101) fused at the N-terminus to the cell-permeable Antennapedia internalization sequence (43-58). This peptide is reported to block eNOS activity and cellular NO release in vitro and reduce inflammation and tumorigenesis in vivo. Caveolin-1 interacts with several lipid-modified signaling ligands, such as EGFR, eNOS, G-protein α-subunits, PKCα, H-Ras, and Src, via the C1-SD82-101 sequence.
      Catalogue Number219482
      Brand Family Calbiochem®
      SynonymsAP-Cav, Pen-C1-SD, RQIKIWFQNRRMKWKK-DGIWKASFTTFTVTKYWFYR, Cavtratin
      References
      ReferencesBernatchez, P.N., et al. 2005. Proc. Natl. Acad. Sci. USA 102, 761.
      Williams, T.M., et al. 2004. J. Biol. Chem. 279, 51630.
      Gratton, J.P., et al. 2003. Cancer Cell 4, 31.
      Sukumaran, S.K., et al. 2002. J. Biol. Chem. 277, 50716.
      Liu, J., et al. 2002. J. Biol. Chem. 277, 10661.
      Bucci, M., et al. 2000. Nat. Med. 6, 1362.
      Okamoto, T., et al. 1998. J. Biol. Chem. 273, 5419.
      Product Information
      ATP CompetitiveN
      FormWhite lyophilized solid
      FormulationSupplied as a trifluoroacetate salt.
      Hill FormulaC₂₂₈H₃₃₅N₆₁O₄₉S
      Chemical formulaC₂₂₈H₃₃₅N₆₁O₄₉S
      Hygroscopic Hygroscopic
      ReversibleN
      Quality LevelMQ100
      Applications
      ApplicationCaveolin-1 Scaffolding Domain Peptide, Cell-permeable, blocks eNOS activity and cellular NO release in vitro and reduces inflammation and tumorigenesis in vivo.
      Biological Information
      Primary TargeteNOS
      Purity≥95% by HPLC
      Physicochemical Information
      Cell permeableY
      Peptide SequenceH-Arg-Gln-Ile-Lys-Ile-Trp-Phe-Gln-Asn-Arg-Arg-Met-Lys-Trp-Lys-Lys-Asp-Gly-Ile-Trp-Lys-Ala-Ser-Phe-Thr-Thr-Phe-Thr-Val-Thr-Lys-Tyr-Trp-Phe-Tyr-Arg-OH
      Dimensions
      Materials Information
      Toxicological Information
      Safety Information according to GHS
      Safety Information
      Product Usage Statements
      Storage and Shipping Information
      Ship Code Shipped with Blue Ice or with Dry Ice
      Toxicity Carcinogenic / Teratogenic
      Storage -20°C
      Protect from Light Protect from light
      Hygroscopic Hygroscopic
      Do not freeze Ok to freeze
      Special InstructionsFollowing reconstitution, aliquot and freeze (-20°C). Stock solutions are stable for up to 3 months at -20°C.
      Packaging Information
      Packaged under inert gas Packaged under inert gas
      Transport Information
      Supplemental Information
      Specifications
      Global Trade Item Number
      Número de catálogo GTIN
      219482-1MG 04055977218565

      Documentation

      Caveolin-1 Scaffolding Domain Peptide, Cell-permeable - Calbiochem MSDS

      Título

      Ficha de Segurança de Produtos (MSDS) 

      Caveolin-1 Scaffolding Domain Peptide, Cell-permeable - Calbiochem Certificados de análise

      TítuloNúmero do lote
      219482

      Referências

      Visão geral de referência
      Bernatchez, P.N., et al. 2005. Proc. Natl. Acad. Sci. USA 102, 761.
      Williams, T.M., et al. 2004. J. Biol. Chem. 279, 51630.
      Gratton, J.P., et al. 2003. Cancer Cell 4, 31.
      Sukumaran, S.K., et al. 2002. J. Biol. Chem. 277, 50716.
      Liu, J., et al. 2002. J. Biol. Chem. 277, 10661.
      Bucci, M., et al. 2000. Nat. Med. 6, 1362.
      Okamoto, T., et al. 1998. J. Biol. Chem. 273, 5419.
      Ficha de dados

      Note that this data sheet is not lot-specific and is representative of the current specifications for this product. Please consult the vial label and the certificate of analysis for information on specific lots. Also note that shipping conditions may differ from storage conditions.

      Revision05-June-2008 RFH
      SynonymsAP-Cav, Pen-C1-SD, RQIKIWFQNRRMKWKK-DGIWKASFTTFTVTKYWFYR, Cavtratin
      DescriptionCaveolin-1 scaffolding domain peptide (C1-SD82-101) fused at the N-terminus to the cell-permeable Antennapedia internalization sequence (43-58). This peptide is reported to block eNOS activity and cellular NO release in vitro and reduce inflammation and tumorigenesis in vivo. Caveolin-1 interacts with several lipid-modified signaling ligands, such as EGFR, eNOS, G-protein α-subunits, PKCα, H-Ras, and Src, via the C1-SD82-101 sequence.
      FormWhite lyophilized solid
      FormulationSupplied as a trifluoroacetate salt.
      Intert gas (Yes/No) Packaged under inert gas
      Chemical formulaC₂₂₈H₃₃₅N₆₁O₄₉S
      Peptide SequenceH-Arg-Gln-Ile-Lys-Ile-Trp-Phe-Gln-Asn-Arg-Arg-Met-Lys-Trp-Lys-Lys-Asp-Gly-Ile-Trp-Lys-Ala-Ser-Phe-Thr-Thr-Phe-Thr-Val-Thr-Lys-Tyr-Trp-Phe-Tyr-Arg-OH
      Purity≥95% by HPLC
      SolubilityDMSO (2 mg/ml)
      Storage Protect from light
      -20°C
      Hygroscopic
      Do Not Freeze Ok to freeze
      Special InstructionsFollowing reconstitution, aliquot and freeze (-20°C). Stock solutions are stable for up to 3 months at -20°C.
      Toxicity Carcinogenic / Teratogenic
      ReferencesBernatchez, P.N., et al. 2005. Proc. Natl. Acad. Sci. USA 102, 761.
      Williams, T.M., et al. 2004. J. Biol. Chem. 279, 51630.
      Gratton, J.P., et al. 2003. Cancer Cell 4, 31.
      Sukumaran, S.K., et al. 2002. J. Biol. Chem. 277, 50716.
      Liu, J., et al. 2002. J. Biol. Chem. 277, 10661.
      Bucci, M., et al. 2000. Nat. Med. 6, 1362.
      Okamoto, T., et al. 1998. J. Biol. Chem. 273, 5419.