Millipore Sigma Vibrant Logo

05-23-2005 Neuropeptide Y, Human - CAS 90880-35-6 - Calbiochem

A potent vasoconstrictor.

MSDS (material safety data sheet) or SDS, CoA and CoQ, dossiers, brochures and other available documents.

Synonyms: NPY, Human, YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY-NH₂

Primary Target: A potent vasoconstrictor
View Products on Sigmaaldrich.com
05-23-2005
View Pricing & Availability

Overview

Replacement Information

Key Spec Table

CAS #Empirical Formula
90880-35-6C₁₈₉H₂₈₅N₅₅O₅₇S

Pricing & Availability

Catalogue Number AvailabilityPackaging Qty/Pack Price Quantity
US105232005-0.5MG
Retrieving availability...
—
Limited Availability Limited Availability
In Stock 
Discontinued
Limited Quantities Available
Availability to be confirmed
    Remaining : Will advise
      Remaining : Will advise
      Will advise
      Contact Customer Service
      Contact Customer Service

      		 Glass bottle .5 mg
      Retrieving price...
      Price could not be retrieved
      Minimum Quantity is a multiple of
      Maximum Quantity is
      Upon Order Completion More Information
      You Saved ()
       
      —
      Request Pricing
      		 —
      Description
      OverviewA potent vasoconstrictor. Reversibly inhibits Ca2+-activated K+ channels in vascular smooth muscle cells.
      Catalogue Number05-23-2005
      Brand Family Calbiochem®
      SynonymsNPY, Human, YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY-NH₂
      References
      ReferencesXiong, Z., and Cheung, D.W. 1994. Pflugers Arch. 429, 280.
      Wahlestedt, C., et al. 1993. Science 259, 528.
      Leibowitz, S.F. 1992. NeuroReport 3, 1023.
      Product Information
      CAS number90880-35-6
      ATP CompetitiveN
      FormWhite to off-white lyophilized solid
      FormulationSupplied as trifluoroacetate salt. Sold on the basis of peptide content.
      Hill FormulaC₁₈₉H₂₈₅N₅₅O₅₇S
      Chemical formulaC₁₈₉H₂₈₅N₅₅O₅₇S
      ReversibleY
      Sold on the basis of peptide contentY
      Quality LevelMQ100
      Applications
      Biological Information
      Primary TargetA potent vasoconstrictor
      Purity≥97% by HPLC
      Physicochemical Information
      Cell permeableN
      Peptide ContentY
      Peptide SequenceH-Tyr-Pro-Ser-Lys-Pro-Asp-Asn-Pro-Gly-Glu-Asp-Ala-Pro-Ala-Glu-Asp-Met-Ala-Arg-Tyr-Tyr-Ser-Ala-Leu-Arg-His-Tyr-Ile-Asn-Leu-Ile-Thr-Arg-Gln-Arg-Tyr-NH₂
      Dimensions
      Materials Information
      Toxicological Information
      Safety Information according to GHS
      Safety Information
      R PhraseR: 20/21/22

      Harmful by inhalation, in contact with skin and if swallowed.
      S PhraseS: 36

      Wear suitable protective clothing.
      Product Usage Statements
      Storage and Shipping Information
      Ship Code Ambient Temperature Only
      Toxicity Harmful
      Storage -20°C
      Protect from Moisture Protect from moisture
      Do not freeze Ok to freeze
      Special InstructionsFollowing reconstitution, aliquot and freeze (-20°C). Stock solutions are stable for up to 3 months at -20°C.
      Packaging Information
      Transport Information
      Supplemental Information
      Specifications
      Global Trade Item Number
      Catalogue Number GTIN
      US105232005-0.5MG 04055977206371

      Documentation

      Neuropeptide Y, Human - CAS 90880-35-6 - Calbiochem SDS

      Title

      Safety Data Sheet (SDS) 

      Neuropeptide Y, Human - CAS 90880-35-6 - Calbiochem Certificates of Analysis

      TitleLot Number
      05-23-2005

      References

      Reference overview
      Xiong, Z., and Cheung, D.W. 1994. Pflugers Arch. 429, 280.
      Wahlestedt, C., et al. 1993. Science 259, 528.
      Leibowitz, S.F. 1992. NeuroReport 3, 1023.
      Data Sheet

      Note that this data sheet is not lot-specific and is representative of the current specifications for this product. Please consult the vial label and the certificate of analysis for information on specific lots. Also note that shipping conditions may differ from storage conditions.

      Revision18-September-2008 RFH
      SynonymsNPY, Human, YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY-NH₂
      DescriptionA potent vasoconstrictor. Reversibly inhibits Ca2+-activated K+ channels in vascular smooth muscle cells.
      FormWhite to off-white lyophilized solid
      FormulationSupplied as trifluoroacetate salt. Sold on the basis of peptide content.
      CAS number90880-35-6
      Chemical formulaC₁₈₉H₂₈₅N₅₅O₅₇S
      Peptide SequenceH-Tyr-Pro-Ser-Lys-Pro-Asp-Asn-Pro-Gly-Glu-Asp-Ala-Pro-Ala-Glu-Asp-Met-Ala-Arg-Tyr-Tyr-Ser-Ala-Leu-Arg-His-Tyr-Ile-Asn-Leu-Ile-Thr-Arg-Gln-Arg-Tyr-NH₂
      Purity≥97% by HPLC
      Solubility5% Acetic acid (1 mg/ml)
      Storage Protect from moisture
      -20°C
      Do Not Freeze Ok to freeze
      Special InstructionsFollowing reconstitution, aliquot and freeze (-20°C). Stock solutions are stable for up to 3 months at -20°C.
      Toxicity Harmful
      Merck USA index14, 6485
      ReferencesXiong, Z., and Cheung, D.W. 1994. Pflugers Arch. 429, 280.
      Wahlestedt, C., et al. 1993. Science 259, 528.
      Leibowitz, S.F. 1992. NeuroReport 3, 1023.