508761 Sigma-AldrichPCSK9 Inhibitor, EGF-A - Calbiochem
Produits recommandés
Aperçu
Replacement Information |
---|
Tableau de caractéristiques principal
Empirical Formula |
---|
C₁₈₈H₂₉₂N₅₈O₆₅S₆ |
Products
Référence | Conditionnement | Qté | |
---|---|---|---|
5087610001 | Flacon en verre | 1 mg |
References | |
---|---|
References | Shan L, et al. 2008. Biochem Biophys Res Commun. 375, 69. Da-Wei Zhang, et al. 2007. J. Biol. Chem. 282, 18602. |
Product Information | |
---|---|
Form | White powder |
Hill Formula | C₁₈₈H₂₉₂N₅₈O₆₅S₆ |
Chemical formula | C₁₈₈H₂₉₂N₅₈O₆₅S₆ |
Hygroscopic | Hygroscopic |
Quality Level | MQ100 |
Applications |
---|
Biological Information | |
---|---|
Primary Target | PCSK9 |
Primary Target K<sub>i</sub> | 0.3 µ |
Purity | ≥95% by HPLC |
Physicochemical Information | |
---|---|
Peptide Sequence | GTNECLDNNGGCSHVCNDLKIGYECLCPDGFQLVAQRRCEDI-NH2 (Disulfide Bridge: 5-16, 12-25, 27-39) |
Dimensions |
---|
Materials Information |
---|
Toxicological Information |
---|
Safety Information according to GHS |
---|
Safety Information |
---|
Product Usage Statements |
---|
Packaging Information | |
---|---|
Packaged under inert gas | Packaged under inert gas |
Transport Information |
---|
Supplemental Information |
---|
Specifications |
---|
Global Trade Item Number | |
---|---|
Référence | GTIN |
5087610001 | 04055977261387 |
Documentation
PCSK9 Inhibitor, EGF-A - Calbiochem FDS
Titre |
---|
Références bibliographiques
Aperçu de la référence bibliographique |
---|
Shan L, et al. 2008. Biochem Biophys Res Commun. 375, 69. Da-Wei Zhang, et al. 2007. J. Biol. Chem. 282, 18602. |
Brochure
Titre |
---|
NPI Flyer- Epigenetics and Nuclear Function Feature |
New Products - Antibodies, Small Molecule, Inhibitors |
Informations techniques
Titre |
---|
White Paper: Further considerations of antibody validation and usage. |