Millipore Sigma Vibrant Logo
Attention: We have moved. Merck Millipore products are no longer available for purchase on MerckMillipore.com.Learn More

219482 Caveolin-1 Scaffolding Domain Peptide, Cell-permeable - Calbiochem

Caveolin-1 Scaffolding Domain Peptide, Cell-permeable, blocks eNOS activity and cellular NO release in vitro and reduces inflammation and tumorigenesis in vivo.

FDS (Fiches de données de sécurité), certificats d’analyse (CoA) et de qualité (CoQ), dossiers, brochures et autres documents disponibles.

Synonymes: AP-Cav, Pen-C1-SD, RQIKIWFQNRRMKWKK-DGIWKASFTTFTVTKYWFYR, Cavtratin

Primary Target: eNOS
219482
Purchase on Sigma-Aldrich

Aperçu

Replacement Information

Tableau de caractéristiques principal

Empirical Formula
C₂₂₈H₃₃₅N₆₁O₄₉S

Products

RéférenceConditionnement Qté
219482-1MG Ampoule plast. 1 mg
Description
OverviewCaveolin-1 scaffolding domain peptide (C1-SD82-101) fused at the N-terminus to the cell-permeable Antennapedia internalization sequence (43-58). This peptide is reported to block eNOS activity and cellular NO release in vitro and reduce inflammation and tumorigenesis in vivo. Caveolin-1 interacts with several lipid-modified signaling ligands, such as EGFR, eNOS, G-protein α-subunits, PKCα, H-Ras, and Src, via the C1-SD82-101 sequence.
Catalogue Number219482
Brand Family Calbiochem®
SynonymsAP-Cav, Pen-C1-SD, RQIKIWFQNRRMKWKK-DGIWKASFTTFTVTKYWFYR, Cavtratin
References
ReferencesBernatchez, P.N., et al. 2005. Proc. Natl. Acad. Sci. USA 102, 761.
Williams, T.M., et al. 2004. J. Biol. Chem. 279, 51630.
Gratton, J.P., et al. 2003. Cancer Cell 4, 31.
Sukumaran, S.K., et al. 2002. J. Biol. Chem. 277, 50716.
Liu, J., et al. 2002. J. Biol. Chem. 277, 10661.
Bucci, M., et al. 2000. Nat. Med. 6, 1362.
Okamoto, T., et al. 1998. J. Biol. Chem. 273, 5419.
Product Information
ATP CompetitiveN
FormWhite lyophilized solid
FormulationSupplied as a trifluoroacetate salt.
Hill FormulaC₂₂₈H₃₃₅N₆₁O₄₉S
Chemical formulaC₂₂₈H₃₃₅N₆₁O₄₉S
Hygroscopic Hygroscopic
ReversibleN
Quality LevelMQ100
Applications
ApplicationCaveolin-1 Scaffolding Domain Peptide, Cell-permeable, blocks eNOS activity and cellular NO release in vitro and reduces inflammation and tumorigenesis in vivo.
Biological Information
Primary TargeteNOS
Purity≥95% by HPLC
Physicochemical Information
Cell permeableY
Peptide SequenceH-Arg-Gln-Ile-Lys-Ile-Trp-Phe-Gln-Asn-Arg-Arg-Met-Lys-Trp-Lys-Lys-Asp-Gly-Ile-Trp-Lys-Ala-Ser-Phe-Thr-Thr-Phe-Thr-Val-Thr-Lys-Tyr-Trp-Phe-Tyr-Arg-OH
Dimensions
Materials Information
Toxicological Information
Safety Information according to GHS
Safety Information
Product Usage Statements
Storage and Shipping Information
Ship Code Shipped with Blue Ice or with Dry Ice
Toxicity Carcinogenic / Teratogenic
Storage -20°C
Protect from Light Protect from light
Hygroscopic Hygroscopic
Do not freeze Ok to freeze
Special InstructionsFollowing reconstitution, aliquot and freeze (-20°C). Stock solutions are stable for up to 3 months at -20°C.
Packaging Information
Packaged under inert gas Packaged under inert gas
Transport Information
Supplemental Information
Specifications
Global Trade Item Number
Référence GTIN
219482-1MG 04055977218565

Documentation

Caveolin-1 Scaffolding Domain Peptide, Cell-permeable - Calbiochem FDS

Titre

Fiche de données de sécurité des matériaux (FDS) 

Caveolin-1 Scaffolding Domain Peptide, Cell-permeable - Calbiochem Certificats d'analyse

TitreNuméro de lot
219482

Références bibliographiques

Aperçu de la référence bibliographique
Bernatchez, P.N., et al. 2005. Proc. Natl. Acad. Sci. USA 102, 761.
Williams, T.M., et al. 2004. J. Biol. Chem. 279, 51630.
Gratton, J.P., et al. 2003. Cancer Cell 4, 31.
Sukumaran, S.K., et al. 2002. J. Biol. Chem. 277, 50716.
Liu, J., et al. 2002. J. Biol. Chem. 277, 10661.
Bucci, M., et al. 2000. Nat. Med. 6, 1362.
Okamoto, T., et al. 1998. J. Biol. Chem. 273, 5419.
Fiche technique

Note that this data sheet is not lot-specific and is representative of the current specifications for this product. Please consult the vial label and the certificate of analysis for information on specific lots. Also note that shipping conditions may differ from storage conditions.

Revision05-June-2008 RFH
SynonymsAP-Cav, Pen-C1-SD, RQIKIWFQNRRMKWKK-DGIWKASFTTFTVTKYWFYR, Cavtratin
DescriptionCaveolin-1 scaffolding domain peptide (C1-SD82-101) fused at the N-terminus to the cell-permeable Antennapedia internalization sequence (43-58). This peptide is reported to block eNOS activity and cellular NO release in vitro and reduce inflammation and tumorigenesis in vivo. Caveolin-1 interacts with several lipid-modified signaling ligands, such as EGFR, eNOS, G-protein α-subunits, PKCα, H-Ras, and Src, via the C1-SD82-101 sequence.
FormWhite lyophilized solid
FormulationSupplied as a trifluoroacetate salt.
Intert gas (Yes/No) Packaged under inert gas
Chemical formulaC₂₂₈H₃₃₅N₆₁O₄₉S
Peptide SequenceH-Arg-Gln-Ile-Lys-Ile-Trp-Phe-Gln-Asn-Arg-Arg-Met-Lys-Trp-Lys-Lys-Asp-Gly-Ile-Trp-Lys-Ala-Ser-Phe-Thr-Thr-Phe-Thr-Val-Thr-Lys-Tyr-Trp-Phe-Tyr-Arg-OH
Purity≥95% by HPLC
SolubilityDMSO (2 mg/ml)
Storage Protect from light
-20°C
Hygroscopic
Do Not Freeze Ok to freeze
Special InstructionsFollowing reconstitution, aliquot and freeze (-20°C). Stock solutions are stable for up to 3 months at -20°C.
Toxicity Carcinogenic / Teratogenic
ReferencesBernatchez, P.N., et al. 2005. Proc. Natl. Acad. Sci. USA 102, 761.
Williams, T.M., et al. 2004. J. Biol. Chem. 279, 51630.
Gratton, J.P., et al. 2003. Cancer Cell 4, 31.
Sukumaran, S.K., et al. 2002. J. Biol. Chem. 277, 50716.
Liu, J., et al. 2002. J. Biol. Chem. 277, 10661.
Bucci, M., et al. 2000. Nat. Med. 6, 1362.
Okamoto, T., et al. 1998. J. Biol. Chem. 273, 5419.