Millipore Sigma Vibrant Logo
Attention: We have moved. Merck Millipore products are no longer available for purchase on MerckMillipore.com.Learn More

374087 Anti-Heme Oxygenase-1 Mouse mAb (HO-1-1)

374087
Purchase on Sigma-Aldrich

Overview

Replacement Information

Key Spec Table

Species ReactivityHostAntibody Type
B, Ca, H, Mk, M, RMMonoclonal Antibody

Products

Catalogue NumberPackaging Qty/Pack
374087-200UG Plastic ampoule 200 μg
Description
OverviewRecognizes the ~32 kDa HO-1 protein.
Catalogue Number374087
Brand Family Calbiochem®
SynonymsAnti-HO-1, Anti-Hsp32
Application Data
Detection of human heme oxygenase-1 by immunoblotting. Sample: Extract from human microsomes. Primary antibody: Anti-Heme Oxygenase-1 Mouse mAb (HO-1-1) (Cat. No. 374087) (1:250). Detection: chemiluminescence.

Detection of human heme oxygenase-1 by flow cytometry. Sample: Human lung cancer A2 cells (both panels). Primary antibodies: Isotope control (left panel) and Anti-Heme Oxygenase-1 Mouse mAb (HO-1-1) (right panel) (Cat. No. 374087) (10 µg/ml). Detection: fluorescence.
References
ReferencesYoshida, T., et al. 1988. Eur. J. Biochem. 171, 457.
Maines, M.D. 1988. FASEB J. 2, 2557.
Trakshel, G.M., et al. 1986 J. Biol. Chem. 261, 11131.
Product Information
FormLiquid
FormulationIn PBS, 50% glycerol.
Preservative≤0.1% sodium azide
Quality LevelMQ100
Applications
Key Applications Immunoblotting (Western Blotting)
Immunocytochemistry
Immunoprecipitation
Application NotesImmunoblotting (4 µg/ml, chemiluminescence)
Immunocytochemistry (1:1000)
Immunoprecipitation (20 µg/ml)
Application CommentsDoes not cross-react with HO-2. Variables associated with assay conditions will dictate the proper working dilution.
Biological Information
Immunogena synthetic peptide (MERPQPDSMPQDLSEALKEATKEVHTQAEN) corresponding to amino acids 1-30 of human HO-1 prepared as a four-branched multiple antigen peptide
ImmunogenHuman
CloneHO-1-1
HostMouse
IsotypeIgG₁
Species Reactivity
  • Bovine
  • Canine
  • Human
  • Monkey
  • Mouse
  • Rat
Antibody TypeMonoclonal Antibody
Concentration Label Please refer to vial label for lot-specific concentration
Physicochemical Information
Dimensions
Materials Information
Toxicological Information
Safety Information according to GHS
Safety Information
Product Usage Statements
Storage and Shipping Information
Ship Code Blue Ice Only
Toxicity Standard Handling
Storage -20°C
Avoid freeze/thaw Avoid freeze/thaw
Do not freeze Ok to freeze
Special InstructionsFollowing initial thaw, aliquot and freeze (-20°C).
Packaging Information
Transport Information
Supplemental Information
Specifications
Global Trade Item Number
Catalogue Number GTIN
374087-200UG 04055977191165

Documentation

Anti-Heme Oxygenase-1 Mouse mAb (HO-1-1) SDS

Title

Safety Data Sheet (SDS) 

Anti-Heme Oxygenase-1 Mouse mAb (HO-1-1) Certificates of Analysis

TitleLot Number
374087

References

Reference overview
Yoshida, T., et al. 1988. Eur. J. Biochem. 171, 457.
Maines, M.D. 1988. FASEB J. 2, 2557.
Trakshel, G.M., et al. 1986 J. Biol. Chem. 261, 11131.
Data Sheet

Note that this data sheet is not lot-specific and is representative of the current specifications for this product. Please consult the vial label and the certificate of analysis for information on specific lots. Also note that shipping conditions may differ from storage conditions.

Revision11-November-2011 JSW
SynonymsAnti-HO-1, Anti-Hsp32
ApplicationImmunoblotting (4 µg/ml, chemiluminescence)
Immunocytochemistry (1:1000)
Immunoprecipitation (20 µg/ml)
Application Data
Detection of human heme oxygenase-1 by immunoblotting. Sample: Extract from human microsomes. Primary antibody: Anti-Heme Oxygenase-1 Mouse mAb (HO-1-1) (Cat. No. 374087) (1:250). Detection: chemiluminescence.

Detection of human heme oxygenase-1 by flow cytometry. Sample: Human lung cancer A2 cells (both panels). Primary antibodies: Isotope control (left panel) and Anti-Heme Oxygenase-1 Mouse mAb (HO-1-1) (right panel) (Cat. No. 374087) (10 µg/ml). Detection: fluorescence.
DescriptionProtein G purified mouse monoclonal antibody. Recognizes the ~32 kDa heme oxygenase (HO-1) protein.
BackgroundHeme oxygenase (HO) is a microsomal enzyme that oxidatively cleaves heme, a pro-oxidant, into carbon monoxide and biliverdin, which is reduced to the antioxidant, bilirubin. Two isozymes, termed HO-1 and HO-2, have been identified in rat, rabbit, monkey, and human tissues. By SDS-PAGE, mammalian HO-1 is ~31-33 kDa; HO-2 is ~36 kDa. HO-1, also referred to as stress protein Hsp32, is the inducible form of the enzyme. Expression of HO-1 can be induced by a variety of stimuli such as heme, metals, hormones, UV radiation and sulfhydryl depleting agents. In contrast, HO-2 is the constitutive form of the enzyme. HO-2 is the most prevalent form in most tissues, except the spleen where HO-1 levels are predominant.
HostMouse
Immunogen speciesHuman
Immunogena synthetic peptide (MERPQPDSMPQDLSEALKEATKEVHTQAEN) corresponding to amino acids 1-30 of human HO-1 prepared as a four-branched multiple antigen peptide
CloneHO-1-1
IsotypeIgG₁
Speciesbovine, canine, human, monkey, mouse, rat
FormLiquid
FormulationIn PBS, 50% glycerol.
Concentration Label Please refer to vial label for lot-specific concentration
Preservative≤0.1% sodium azide
CommentsDoes not cross-react with HO-2. Variables associated with assay conditions will dictate the proper working dilution.
Storage Avoid freeze/thaw
-20°C
Do Not Freeze Ok to freeze
Special InstructionsFollowing initial thaw, aliquot and freeze (-20°C).
Toxicity Standard Handling
ReferencesYoshida, T., et al. 1988. Eur. J. Biochem. 171, 457.
Maines, M.D. 1988. FASEB J. 2, 2557.
Trakshel, G.M., et al. 1986 J. Biol. Chem. 261, 11131.