219483 Sigma-AldrichCaveolin-1 Scaffolding Domain Peptide, Cell-permeable, Negative Control - Calbiochem
More>>
Less<<
Primary Target:
Negative control for studies using Caveolin-1 Scaffolding Domain Peptide, Cell-permeable (Cat. No. 219482).
MSDS (material safety data sheet) or SDS, CoA and CoQ, dossiers, brochures and other available documents.
Synonyms: AP-Cav-X, Pen-C1-SD-X, RQIKIWFQNRRMKWKK-WGIDKASFTTFTVTKYWFRY
Recommended Products
-
1467510020 Millipore Readyplate XLD Agar acc ISO 6579 -
MAB8906-KC Sigma-Aldrich Anti-Measles, nucleoprotein, clone 83KKII (1mg) KC -
115228 Millipore N,N-Bis(2-hydroxyethyl)-2-aminoethanesulfonic acid -
341492 Sigma-Aldrich FeTPPS - Calbiochem -
MABF3366-25UG Sigma-Aldrich Anti-Adenovirus 5 DBP Antibody, clone B6-8 -
ABC1687-100UG Sigma-Aldrich Anti-Heparanase-1 -
557440 Sigma-Aldrich Ru360 - Calbiochem -
ALP30 Sigma-Aldrich Apolipoprotein B, human -
MABS2229-100UG Sigma-Aldrich Anti-UGT1A9 Antibody, clone 14G11 -
820617 Sigma-Aldrich O-Benzylhydroxylamine
Overview
Key Spec Table
| Empirical Formula |
|---|
| C₂₂₈H₃₃₅N₆₁O₄₉S |
| Description | |
|---|---|
| Overview | This product has been discontinued. A scrambled caveolin-1 scaffolding domain peptide (C1-SD82-101) fused at the N-terminus to the Antennapedia internalization sequence (43-58). Serves as an useful negative control for studies using Caveolin-1 Scaffolding Domain Peptide, Cell-permeable (Cat. No. 219482). |
| Catalogue Number | 219483 |
| Brand Family | Calbiochem® |
| Synonyms | AP-Cav-X, Pen-C1-SD-X, RQIKIWFQNRRMKWKK-WGIDKASFTTFTVTKYWFRY |
| References | |
|---|---|
| References | Gratton, J.P., et al. 2003. Cancer Cell 4, 31. Sukumaran, S.K., et al. 2002. J. Biol. Chem. 277, 50716. Bucci, M., et al. 2000. Nat. Med. 6, 1362. |
| Product Information | |
|---|---|
| ATP Competitive | N |
| Form | White lyophilized solid |
| Formulation | Supplied as a trifluoroacetate salt. |
| Hill Formula | C₂₂₈H₃₃₅N₆₁O₄₉S |
| Chemical formula | C₂₂₈H₃₃₅N₆₁O₄₉S |
| Hygroscopic | Hygroscopic |
| Reversible | N |
| Quality Level | MQ100 |
| Biological Information | |
|---|---|
| Primary Target | Negative control for studies using Caveolin-1 Scaffolding Domain Peptide, Cell-permeable (Cat. No. 219482). |
| Purity | ≥95% by HPLC |
| Packaging Information | |
|---|---|
| Packaged under inert gas | Packaged under inert gas |
| Global Trade Item Number | |
|---|---|
| Catalogue Number | GTIN |
| 219483 | 0 |