508514 Sigma-AldrichPsalmotoxin-1 - CAS 316808-68-1 - Calbiochem
A potent proton-gated sodium channel (ASIC1a) channel blocking neurotoxin (IC₅₀ = 0.9 nM) that can distinguish between the two ASIC1 splice variants, ASIC1a and ASIC1b.
More>> A potent proton-gated sodium channel (ASIC1a) channel blocking neurotoxin (IC₅₀ = 0.9 nM) that can distinguish between the two ASIC1 splice variants, ASIC1a and ASIC1b. Less<<Synonyme: ASIC1a Inhibitor, Psalmotoxin 1
Empfohlene Produkte
-
573108-10MG Sigma-Aldrich STAT5 Inhibitor - CAS 285986-31-4 - Calbiochem -
1464290100 Millipore CASO-Agar (Röhrchen 18ml) -
NU300150/460-321 Millipore NA3inch TOV 180° 1.4435, b. 45°, TC -
239825-15MG Sigma-Aldrich InSolution™ CXCR4 Antagonist I, AMD3100 - CAS 155148-31-5 - Calbiochem -
ZMQSFTSA1 Milli-Q Fußpedal -
96100009 Millipore Verlängerungskit für Vantage L-Laborsäulen -
341608 Sigma-Aldrich FGF Receptor Tyrosine Kinase Inhibitor - CAS 192705-79-6 - Calbiochem -
ZRDSVCL3SP Milli-Q ZRDSVCL3SP
Übersicht
Key Spec Table
CAS # | Empirical Formula |
---|---|
316808-68-1 | C₂₀₀H₃₁₂N₆₂O₅₇S₆ |
Preis & Verfügbarkeit
Bestellnummer | Verfügbarkeit | Verpackung | St./Pkg. | Preis | Menge | |
---|---|---|---|---|---|---|
5085140001 |
|
Glasflasche | 20 μg |
|
— |
References | |
---|---|
References | Qadri, Y. J. et al. 2009. J. Biol. Chem. 284, 17625. M. Mazzuca, et al. 2007. Nat Neurosci. 10, 943. Escoubas, P. et al. 2000. J. Biol. Chem. 275, 25116. |
Product Information | |
---|---|
CAS number | 316808-68-1 |
Form | Colorless semi-solid to viscous liquid |
Hill Formula | C₂₀₀H₃₁₂N₆₂O₅₇S₆ |
Chemical formula | C₂₀₀H₃₁₂N₆₂O₅₇S₆ |
Hygroscopic | Hygroscopic |
Quality Level | MQ100 |
Biological Information | |
---|---|
Primary Target | ASIC1a |
Primary Target IC<sub>50</sub> | 0.9 nM |
Purity | ≥94% by HPLC |
Physicochemical Information | |
---|---|
Peptide Sequence | EDCIPKWKGCVNRHGDCCEGLECWKRRRSFEVCVPKTPKT (disulfide bond 3-18, 10-23, 17-33) |
Global Trade Item Number | |
---|---|
Bestellnummer | GTIN |
5085140001 | 04055977262056 |