Millipore Sigma Vibrant Logo

05-23-2151 PACAP 27 Amide, Ovine - CAS 127317-03-7 - Calbiochem

Increases cAMP levels in a dose-dependent manner (EC₅₀ = 4.7 nM).

SDB (Sicherheitsdatenblätter), Analysenzertifikate und Qualitätszertifikate, Dossiers, Broschüren und andere verfügbare Dokumente.

Synonyme: Pituitary Adenylate Cyclase Activating Polypeptide, HSDGIFTDSYSRYRKQMAVKKYLAAVL-NH₂

Primary Target: Increases cAMP levels
View Products on Sigmaaldrich.com
05-23-2151
Preis & Verfügbarkeit

Übersicht

Replacement Information

Key Spec Table

CAS #Empirical Formula
127317-03-7C₁₄₂H₂₂₄N₄₀O₃₉S

Preis & Verfügbarkeit

Bestellnummer VerfügbarkeitVerpackung St./Pkg. Preis Menge
US105232151-0.5MG
Verfügbarkeit wird abgerufen...
—
Eingeschränkte Verfügbarkeit Eingeschränkte Verfügbarkeit
Lieferbar 
Produkt wurde eingestellt
Begrenzter Lagerbestand
Bestätigung der Verfügbarkeit erforderlich
    Restmenge: Angebot folgt
      Restmenge: Angebot folgt
      Bitte erfragen
      Kontakt zum Kundenservice
      Contact Customer Service

      		 Glasflasche .5 mg
      Preis wird abgerufen...
      Preis nicht abrufbar
      Die Mindestmenge muss ein Vielfaches sein von
      Maximum Quantity is
      Bei Bestätigung Weitere Informationen
      Sie haben () gespart
       
      —
      Bitte erfragen
      		 —
      Description
      OverviewIncreases cAMP levels in a dose-dependent manner (EC50 = 4.7 nM). Increases tyrosine hydroxylase expression in chromaffin cells.
      Catalogue Number05-23-2151
      Brand Family Calbiochem®
      SynonymsPituitary Adenylate Cyclase Activating Polypeptide, HSDGIFTDSYSRYRKQMAVKKYLAAVL-NH₂
      References
      ReferencesKobayashi, H., et al. 1994. Brain Res. 647, 145.
      Tatsuno, I., et al. 1990. Biochem. Biophys. Res. Commun. 168, 1027.
      Product Information
      CAS number127317-03-7
      ATP CompetitiveN
      FormWhite to off-white solid
      FormulationSupplied as a trifluoroacetate salt.
      Hill FormulaC₁₄₂H₂₂₄N₄₀O₃₉S
      Chemical formulaC₁₄₂H₂₂₄N₄₀O₃₉S
      Hygroscopic Hygroscopic
      ReversibleN
      Sold on the basis of peptide contentY
      Quality LevelMQ100
      Applications
      Biological Information
      Primary TargetIncreases cAMP levels
      Primary Target IC<sub>50</sub>EC50 = 4.7 nM increasing cAMP levels in a dose-dependent manner
      Purity≥97% by HPLC
      Physicochemical Information
      Cell permeableN
      Peptide ContentY
      Peptide SequenceH-His-Ser-Asp-Gly-Ile-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-NH₂
      Dimensions
      Materials Information
      Toxicological Information
      Safety Information according to GHS
      Safety Information
      Product Usage Statements
      Storage and Shipping Information
      Ship Code Ambient Temperature Only
      Toxicity Standard Handling
      Storage -20°C
      Hygroscopic Hygroscopic
      Do not freeze Ok to freeze
      Special InstructionsFollowing reconstitution, aliquot and freeze (-20°C). Stock solutions are stable for up to 6 months at -20°C.
      Packaging Information
      Transport Information
      Supplemental Information
      Specifications
      Global Trade Item Number
      Bestellnummer GTIN
      US105232151-0.5MG 04055977226676

      Documentation

      PACAP 27 Amide, Ovine - CAS 127317-03-7 - Calbiochem SDB

      Titel

      Sicherheitsdatenblatt (SDB) 

      PACAP 27 Amide, Ovine - CAS 127317-03-7 - Calbiochem Analysenzertifikate

      TitelChargennummer
      05-23-2151

      Literatur

      Übersicht
      Kobayashi, H., et al. 1994. Brain Res. 647, 145.
      Tatsuno, I., et al. 1990. Biochem. Biophys. Res. Commun. 168, 1027.
      Datenblatt

      Note that this data sheet is not lot-specific and is representative of the current specifications for this product. Please consult the vial label and the certificate of analysis for information on specific lots. Also note that shipping conditions may differ from storage conditions.

      Revision12-September-2022 JSW
      SynonymsPituitary Adenylate Cyclase Activating Polypeptide, HSDGIFTDSYSRYRKQMAVKKYLAAVL-NH₂
      DescriptionIncreases cAMP levels in a dose-dependent manner (EC50 = 4.7 nM). Increases tyrosine hydroxylase expression in chromaffin cells.
      FormWhite to off-white solid
      FormulationSupplied as a trifluoroacetate salt.
      CAS number127317-03-7
      Chemical formulaC₁₄₂H₂₂₄N₄₀O₃₉S
      Peptide SequenceH-His-Ser-Asp-Gly-Ile-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-NH₂
      Purity≥97% by HPLC
      Solubility5% Acetic acid (1 mg/ml)
      Storage -20°C
      Hygroscopic
      Do Not Freeze Ok to freeze
      Special InstructionsFollowing reconstitution, aliquot and freeze (-20°C). Stock solutions are stable for up to 6 months at -20°C.
      Toxicity Standard Handling
      ReferencesKobayashi, H., et al. 1994. Brain Res. 647, 145.
      Tatsuno, I., et al. 1990. Biochem. Biophys. Res. Commun. 168, 1027.