Millipore Sigma Vibrant Logo

05-23-2005 Neuropeptide Y, Human - CAS 90880-35-6 - Calbiochem

Übersicht

Replacement Information

Key Spec Table

CAS #Empirical Formula
90880-35-6C₁₈₉H₂₈₅N₅₅O₅₇S

Preis & Verfügbarkeit

Bestellnummer VerfügbarkeitVerpackung St./Pkg. Preis Menge
US105232005-0.5MG
Verfügbarkeit wird abgerufen...
Eingeschränkte Verfügbarkeit
Eingeschränkte Verfügbarkeit
Lieferbar 
Produkt wurde eingestellt
Begrenzter Lagerbestand
Bestätigung der Verfügbarkeit erforderlich
    Restmenge: Angebot folgt
      Restmenge: Angebot folgt
      Bitte erfragen
      Kontakt zum Kundenservice
      Contact Customer Service

      Glasflasche .5 mg
      Preis wird abgerufen...
      Preis nicht abrufbar
      Die Mindestmenge muss ein Vielfaches sein von
      Maximum Quantity is
      Bei Bestätigung Weitere Informationen
      Sie haben () gespart
       
      Bitte erfragen
      05-23-2005-1MG
      Verfügbarkeit wird abgerufen...
      Eingeschränkte Verfügbarkeit
Eingeschränkte Verfügbarkeit
      Lieferbar 
      Produkt wurde eingestellt
      Begrenzter Lagerbestand
      Bestätigung der Verfügbarkeit erforderlich
        Restmenge: Angebot folgt
          Restmenge: Angebot folgt
          Bitte erfragen
          Kontakt zum Kundenservice
          Contact Customer Service

          Kst.-Ampulle 1 mg
          Preis wird abgerufen...
          Preis nicht abrufbar
          Die Mindestmenge muss ein Vielfaches sein von
          Maximum Quantity is
          Bei Bestätigung Weitere Informationen
          Sie haben () gespart
           
          Bitte erfragen
          Description
          OverviewA potent vasoconstrictor. Reversibly inhibits Ca2+-activated K+ channels in vascular smooth muscle cells.
          Catalogue Number05-23-2005
          Brand Family Calbiochem®
          SynonymsNPY, Human, YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY-NH₂
          References
          ReferencesXiong, Z., and Cheung, D.W. 1994. Pflugers Arch. 429, 280.
          Wahlestedt, C., et al. 1993. Science 259, 528.
          Leibowitz, S.F. 1992. NeuroReport 3, 1023.
          Product Information
          CAS number90880-35-6
          ATP CompetitiveN
          FormWhite to off-white lyophilized solid
          FormulationSupplied as trifluoroacetate salt. Sold on the basis of peptide content.
          Hill FormulaC₁₈₉H₂₈₅N₅₅O₅₇S
          Chemical formulaC₁₈₉H₂₈₅N₅₅O₅₇S
          ReversibleY
          Sold on the basis of peptide contentY
          Quality LevelMQ100
          Applications
          Biological Information
          Primary TargetA potent vasoconstrictor
          Purity≥97% by HPLC
          Physicochemical Information
          Cell permeableN
          Peptide ContentY
          Peptide SequenceH-Tyr-Pro-Ser-Lys-Pro-Asp-Asn-Pro-Gly-Glu-Asp-Ala-Pro-Ala-Glu-Asp-Met-Ala-Arg-Tyr-Tyr-Ser-Ala-Leu-Arg-His-Tyr-Ile-Asn-Leu-Ile-Thr-Arg-Gln-Arg-Tyr-NH₂
          Dimensions
          Materials Information
          Toxicological Information
          Safety Information according to GHS
          Safety Information
          R PhraseR: 20/21/22

          Harmful by inhalation, in contact with skin and if swallowed.
          S PhraseS: 36

          Wear suitable protective clothing.
          Product Usage Statements
          Storage and Shipping Information
          Ship Code Ambient Temperature Only
          Toxicity Harmful
          Storage -20°C
          Protect from Moisture Protect from moisture
          Do not freeze Ok to freeze
          Special InstructionsFollowing reconstitution, aliquot and freeze (-20°C). Stock solutions are stable for up to 3 months at -20°C.
          Packaging Information
          Transport Information
          Supplemental Information
          Specifications
          Global Trade Item Number
          Bestellnummer GTIN
          US105232005-0.5MG 04055977206371
          05-23-2005-1MG 04055977206388

          Documentation

          Neuropeptide Y, Human - CAS 90880-35-6 - Calbiochem SDB

          Titel

          Sicherheitsdatenblatt (SDB) 

          Neuropeptide Y, Human - CAS 90880-35-6 - Calbiochem Analysenzertifikate

          TitelChargennummer
          05-23-2005

          Literatur

          Übersicht
          Xiong, Z., and Cheung, D.W. 1994. Pflugers Arch. 429, 280.
          Wahlestedt, C., et al. 1993. Science 259, 528.
          Leibowitz, S.F. 1992. NeuroReport 3, 1023.
          Datenblatt

          Note that this data sheet is not lot-specific and is representative of the current specifications for this product. Please consult the vial label and the certificate of analysis for information on specific lots. Also note that shipping conditions may differ from storage conditions.

          Revision18-September-2008 RFH
          SynonymsNPY, Human, YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY-NH₂
          DescriptionA potent vasoconstrictor. Reversibly inhibits Ca2+-activated K+ channels in vascular smooth muscle cells.
          FormWhite to off-white lyophilized solid
          FormulationSupplied as trifluoroacetate salt. Sold on the basis of peptide content.
          CAS number90880-35-6
          Chemical formulaC₁₈₉H₂₈₅N₅₅O₅₇S
          Peptide SequenceH-Tyr-Pro-Ser-Lys-Pro-Asp-Asn-Pro-Gly-Glu-Asp-Ala-Pro-Ala-Glu-Asp-Met-Ala-Arg-Tyr-Tyr-Ser-Ala-Leu-Arg-His-Tyr-Ile-Asn-Leu-Ile-Thr-Arg-Gln-Arg-Tyr-NH₂
          Purity≥97% by HPLC
          Solubility5% Acetic acid (1 mg/ml)
          Storage Protect from moisture
          -20°C
          Do Not Freeze Ok to freeze
          Special InstructionsFollowing reconstitution, aliquot and freeze (-20°C). Stock solutions are stable for up to 3 months at -20°C.
          Toxicity Harmful
          Merck USA index14, 6485
          ReferencesXiong, Z., and Cheung, D.W. 1994. Pflugers Arch. 429, 280.
          Wahlestedt, C., et al. 1993. Science 259, 528.
          Leibowitz, S.F. 1992. NeuroReport 3, 1023.