Millipore Sigma Vibrant Logo

05-23-2405 Calcitonin Gene-Related Peptide-II, Human

05-23-2405
  
Retrieving price...
Price could not be retrieved
Minimum Quantity is a multiple of
Maximum Quantity is
Upon Order Completion More Information
You Saved ()
 
Request Pricing
Limited Availability
Limited Availability
In Stock 
Discontinued
Limited Quantities Available
Availability to be confirmed
    Remaining : Will advise
      Remaining : Will advise
      Will advise
      Contact Customer Service
      Contact Customer Service

       

      Contact Customer Service

      Overview

      Replacement Information

      Key Spec Table

      CAS #Empirical Formula
      98824-26-1C₁₆₂H₂₆₇N₅₁O₄₈S₃
      Description
      OverviewPotent hypotensive agent and vasodilator.
      Catalogue Number05-23-2405
      Brand Family Calbiochem®
      SynonymsCGRP-II, βCGRP, ACNTATCVTHRLAGLLSRSGGMVKSNFVPTNVGSKAF-NH₂
      References
      ReferencesHenke, H., et al. 1987. Brain Res. 410, 404.
      Finberg, R.W., et al. 1986. FEBS Lett. 209, 97.
      Finberg, R.W., et al. 1985. FEBS Lett. 183, 403.
      Product Information
      CAS number98824-26-1
      FormWhite to off-white solid
      FormulationSupplied as a trifluoroacetate salt.
      Hill FormulaC₁₆₂H₂₆₇N₅₁O₄₈S₃
      Chemical formulaC₁₆₂H₂₆₇N₅₁O₄₈S₃
      Hygroscopic Hygroscopic
      Sold on the basis of peptide contentY
      Applications
      Biological Information
      Purity≥95% by HPLC
      Physicochemical Information
      Peptide ContentY
      Peptide SequenceH-Ala-Cys²-Asn-Thr-Ala-Thr-Cys⁷-Val-Thr-His-Arg-Leu-Ala-Gly-Leu-Leu-Ser-Arg-Ser-Gly-Gly-Met-Val-Lys-Ser-Asn-Phe-Val-Pro-Thr-Asn-Val-Gly-Ser-Lys-Ala-Phe-NH₂ (disulfide bond: 2 → 7)
      Dimensions
      Materials Information
      Toxicological Information
      Safety Information according to GHS
      Safety Information
      R PhraseR: 20/21/22

      Harmful by inhalation, in contact with skin and if swallowed.
      S PhraseS: 36

      Wear suitable protective clothing.
      Product Usage Statements
      Storage and Shipping Information
      Ship Code Ambient Temperature Only
      Toxicity Harmful
      Storage -20°C
      Hygroscopic Hygroscopic
      Do not freeze Ok to freeze
      Special InstructionsFollowing reconstitution, aliquot and freeze (-20°C). Stock solutions are stable for up to 1 month at -20°C.
      Packaging Information
      Transport Information
      Supplemental Information
      Specifications
      Global Trade Item Number
      Catalogue Number GTIN
      05-23-2405 0

      Documentation

      Calcitonin Gene-Related Peptide-II, Human Certificates of Analysis

      TitleLot Number
      05-23-2405

      References

      Reference overview
      Henke, H., et al. 1987. Brain Res. 410, 404.
      Finberg, R.W., et al. 1986. FEBS Lett. 209, 97.
      Finberg, R.W., et al. 1985. FEBS Lett. 183, 403.
      Data Sheet

      Note that this data sheet is not lot-specific and is representative of the current specifications for this product. Please consult the vial label and the certificate of analysis for information on specific lots. Also note that shipping conditions may differ from storage conditions.

      Revision18-September-2008 RFH
      SynonymsCGRP-II, βCGRP, ACNTATCVTHRLAGLLSRSGGMVKSNFVPTNVGSKAF-NH₂
      DescriptionPotent hypotensive agent and vasodilator.
      FormWhite to off-white solid
      FormulationSupplied as a trifluoroacetate salt.
      CAS number98824-26-1
      Chemical formulaC₁₆₂H₂₆₇N₅₁O₄₈S₃
      Peptide SequenceH-Ala-Cys²-Asn-Thr-Ala-Thr-Cys⁷-Val-Thr-His-Arg-Leu-Ala-Gly-Leu-Leu-Ser-Arg-Ser-Gly-Gly-Met-Val-Lys-Ser-Asn-Phe-Val-Pro-Thr-Asn-Val-Gly-Ser-Lys-Ala-Phe-NH₂ (disulfide bond: 2 → 7)
      Purity≥95% by HPLC
      Solubility5% Acetic Acid (1 mg/ml) or H₂O (1 mg/ml)
      Storage -20°C
      Hygroscopic
      Do Not Freeze Ok to freeze
      Special InstructionsFollowing reconstitution, aliquot and freeze (-20°C). Stock solutions are stable for up to 1 month at -20°C.
      Toxicity Harmful
      ReferencesHenke, H., et al. 1987. Brain Res. 410, 404.
      Finberg, R.W., et al. 1986. FEBS Lett. 209, 97.
      Finberg, R.W., et al. 1985. FEBS Lett. 183, 403.