Millipore Sigma Vibrant Logo

374087 Anti-Heme Oxygenase-1 Mouse mAb (HO-1-1)

Overview

Key Spec Table

Species ReactivityHostAntibody Type
B, Ca, H, Mk, M, RMMonoclonal Antibody

Pricing & Availability

Catalogue Number AvailabilityPackaging Qty/Pack Price Quantity
374087-200UG
Limited Availability
Limited Availability
In Stock 
Discontinued
Limited Quantities Available
Availability to be confirmed
    Remaining : Will advise
      Remaining : Will advise
      Will advise
      Contact Customer Service
      Contact Customer Service

      Plastic ampoule 200 μg
      Price could not be retrieved
      Minimum Quantity is a multiple of
      Maximum Quantity is
      Upon Order Completion More Information
      You Saved ()
       
      Request Pricing
      Description
      OverviewRecognizes the ~32 kDa HO-1 protein.
      Catalogue Number374087
      Brand Family Calbiochem®
      SynonymsAnti-HO-1, Anti-Hsp32
      Application Data
      Detection of human heme oxygenase-1 by immunoblotting. Sample: Extract from human microsomes. Primary antibody: Anti-Heme Oxygenase-1 Mouse mAb (HO-1-1) (Cat. No. 374087) (1:250). Detection: chemiluminescence.

      Detection of human heme oxygenase-1 by flow cytometry. Sample: Human lung cancer A2 cells (both panels). Primary antibodies: Isotope control (left panel) and Anti-Heme Oxygenase-1 Mouse mAb (HO-1-1) (right panel) (Cat. No. 374087) (10 µg/ml). Detection: fluorescence.
      References
      ReferencesYoshida, T., et al. 1988. Eur. J. Biochem. 171, 457.
      Maines, M.D. 1988. FASEB J. 2, 2557.
      Trakshel, G.M., et al. 1986 J. Biol. Chem. 261, 11131.
      Product Information
      FormLiquid
      FormulationIn PBS, 50% glycerol.
      Preservative≤0.1% sodium azide
      Quality LevelMQ100
      Applications
      Key Applications Immunoblotting (Western Blotting)
      Immunocytochemistry
      Immunoprecipitation
      Application NotesImmunoblotting (4 µg/ml, chemiluminescence)
      Immunocytochemistry (1:1000)
      Immunoprecipitation (20 µg/ml)
      Application CommentsDoes not cross-react with HO-2. Variables associated with assay conditions will dictate the proper working dilution.
      Biological Information
      Immunogena synthetic peptide (MERPQPDSMPQDLSEALKEATKEVHTQAEN) corresponding to amino acids 1-30 of human HO-1 prepared as a four-branched multiple antigen peptide
      ImmunogenHuman
      CloneHO-1-1
      HostMouse
      IsotypeIgG₁
      Species Reactivity
      • Bovine
      • Canine
      • Human
      • Monkey
      • Mouse
      • Rat
      Antibody TypeMonoclonal Antibody
      Concentration Label Please refer to vial label for lot-specific concentration
      Storage and Shipping Information
      Ship Code Blue Ice Only
      Toxicity Standard Handling
      Storage -20°C
      Avoid freeze/thaw Avoid freeze/thaw
      Do not freeze Ok to freeze
      Special InstructionsFollowing initial thaw, aliquot and freeze (-20°C).
      Global Trade Item Number
      Catalogue Number GTIN
      374087-200UG 04055977191165